Structure of PDB 5if6 Chain C |
>5if6C (length=134) Species: 32630 (synthetic construct) [Search protein sequence] |
TQSPALIASQSLGRCTQAKDREGWLALMADDVVIETPIGKSVTNPDGSGI KGKEAVGAFWDTHIADDRVTVTCEETFPSSSPDEIAHILVAHAEFDGGFT SEVRGVFTYRVNKAGLITNLRGYYNLDMMTFGNQ |
|
PDB | 5if6 Sampling and energy evaluation challenges in ligand binding protein design. |
Chain | C |
Resolution | 2.501 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3QZ |
C |
L12 A91 F107 Y124 |
L12 A91 F107 Y124 |
|
|
|