Structure of PDB 5ier Chain C |
>5ierC (length=131) Species: 32630 (synthetic construct) [Search protein sequence] |
QSPALIASQSLWRCTQAHDREGWLALMADDVVIETPIGKSVTNPDGSGIK GKEAVGAFFDTHIAATRLTVTCEETFPSSSPDEIAHILVAHSEFDGGFTS EVRGVFTYRVNKAGLITNLRGYWNLDMMTFG |
|
PDB | 5ier Sampling and energy evaluation challenges in ligand binding protein design. |
Chain | C |
Resolution | 2.005 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3QZ |
C |
L12 T43 Y109 |
L11 T42 Y108 |
|
|
|