Structure of PDB 5hev Chain C

Receptor sequence

>5hevC (length=210) Species: 1244155 (Enterococcus faecium SD3B-2)

MIKVLLVDDHEMVRLGVSSYLSIQEDIEVIGEAENGRQGYEKAMALRPDV
ILMDLVMEEMDGIESTKAILKDWPKAKIIIVTSFIDDEKVYPAIEAGAAG
YLLKTSTAHEIADAIRATQRGERVLEPEVTTKMMEKMSRRNDPVLHEELT
NRENEILMLISEGKSNQEIADELFITLKTVKTHVSNILAKLEVEDRTQAA
IYAFKHGLVK

3D structure

• PDB: 5hev An Adaptive Mutation in Enterococcus faecium LiaR Associated with Antimicrobial Peptide Resistance Mimics Phosphorylation and Stabilizes LiaR in an Activated State.
• Chain: C
• Resolution: 3.192 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	C	D9 D54 V56	D9 D54 V56
BS02	BEF	C	D54 V56 T82 K104	D54 V56 T82 K104

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 10:07:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5hev', asym_id = 'C', title = 'An Adaptive Mutation in Enterococcus faecium Lia...ation and Stabilizes LiaR in an Activated State. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5hev', asym_id='C', title='An Adaptive Mutation in Enterococcus faecium Lia...ation and Stabilizes LiaR in an Activated State. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000160,0003677,0006355', uniprot = '', pdbid = '5hev', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000160,0003677,0006355', uniprot='', pdbid='5hev', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>