Structure of PDB 5ha5 Chain C

Receptor sequence
>5ha5C (length=238) Species: 1293916 (Brucella ovis IntaBari-2002-82-58) [Search protein sequence]
MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAKAQADAL
TAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVAGRAAFD
QPEAVEVWDRVIGVNLEGAFNVSHALVPALKAAKGNVVHLCSVAGFVSGG
STAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSTDWFMNRVMM
KRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLAA
3D structure
PDB5ha5 Crystal structure of an NAD-bound oxidoreductase from Brucella ovis
ChainC
Resolution1.95 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAD C G21 R24 G25 L26 D45 I46 L70 D71 V72 N98 A99 G100 Y163 K167 P193 G194 I195 M196 S198 G13 R16 G17 L18 D37 I38 L62 D63 V64 N90 A91 G92 Y155 K159 P185 G186 I187 M188 S190
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Dec 3 13:08:24 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5ha5', asym_id = 'C', title = 'Crystal structure of an NAD-bound oxidoreductase from Brucella ovis'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5ha5', asym_id='C', title='Crystal structure of an NAD-bound oxidoreductase from Brucella ovis')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '5ha5', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='5ha5', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>