Structure of PDB 5gt0 Chain C

Receptor sequence
>5gt0C (length=106) Species: 9606 (Homo sapiens) [Search protein sequence]
SKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEIL
ELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQA
VLLPKK
3D structure
PDB5gt0 Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
ChainC
Resolution2.82 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C S14 K15 R17 R32 R42 R77 S1 K2 R4 R19 R29 R64
BS02 dna C S14 R29 R42 I43 A45 K75 T76 R77 S1 R16 R29 I30 A32 K62 T63 R64
BS03 MN C G44 A45 G46 G31 A32 G33
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0031507 heterochromatin formation
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000786 nucleosome
GO:0001674 female germ cell nucleus
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gt0, PDBe:5gt0, PDBj:5gt0
PDBsum5gt0
PubMed27992841
UniProtQ96QV6|H2A1A_HUMAN Histone H2A type 1-A (Gene Name=H2AC1)

[Back to BioLiP]