Structure of PDB 5f0m Chain C

Receptor sequence
>5f0mC (length=150) Species: 9606 (Homo sapiens) [Search protein sequence]
TVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRV
KTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPF
RGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKS
3D structure
PDB5f0m Structural Mechanism for Cargo Recognition by the Retromer Complex.
ChainC
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C V88 H132 V85 H129
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0010314 phosphatidylinositol-5-phosphate binding
GO:0019903 protein phosphatase binding
GO:0032266 phosphatidylinositol-3-phosphate binding
GO:0035091 phosphatidylinositol binding
GO:0070273 phosphatidylinositol-4-phosphate binding
GO:0080025 phosphatidylinositol-3,5-bisphosphate binding
GO:1901981 phosphatidylinositol phosphate binding
GO:1905394 retromer complex binding
Biological Process
GO:0009617 response to bacterium
GO:0010324 membrane invagination
GO:0010976 positive regulation of neuron projection development
GO:0015031 protein transport
GO:0022615 protein to membrane docking
GO:0030111 regulation of Wnt signaling pathway
GO:0032456 endocytic recycling
GO:0034499 late endosome to Golgi transport
GO:0042177 negative regulation of protein catabolic process
GO:0046597 negative regulation of viral entry into host cell
GO:0050765 negative regulation of phagocytosis
GO:0051224 negative regulation of protein transport
GO:0070676 intralumenal vesicle formation
GO:2000642 negative regulation of early endosome to late endosome transport
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005829 cytosol
GO:0010008 endosome membrane
GO:0030136 clathrin-coated vesicle
GO:0030904 retromer complex
GO:0031901 early endosome membrane
GO:0032009 early phagosome
GO:0045335 phagocytic vesicle
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5f0m, PDBe:5f0m, PDBj:5f0m
PDBsum5f0m
PubMed27889239
UniProtO60493|SNX3_HUMAN Sorting nexin-3 (Gene Name=SNX3)

[Back to BioLiP]