Structure of PDB 5epo Chain C

Receptor sequence

>5epoC (length=261) Species: 29369 (Clostridium sardiniense)

KRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAARSEELANEVIADIK
KQGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNVNLDKN
LTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVGGGSIVNISTIGSVVP
DISRIAYCVSKSAINSLTQNIALQYARKNIRCNAVLPGLIGTRAALENMT
DEFRDSFLGHVPLNRVGRPEDIANAVLYYASDDSGYVTGMIHEVAGGFAL
GTPQYSEYCPR

3D structure

• PDB: 5epo The three-dimensional structure of Clostridium absonum 7 alpha-hydroxysteroid dehydrogenase: new insights into the conserved arginines for NADP(H) recognition
• Chain: C
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G17 T145 I153 Y158 K162 R194
• Catalytic site (residue number reindexed from 1): G16 T144 I152 Y157 K161 R193
• Enzyme Commision number: 1.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	C	S13 T15 R16 G17 I18 R38 F62 N63 A64 N90 Y91 G92 Y158 K162 P188 G189 I191 T193 R194 A195	S12 T14 R15 G16 I17 R37 F61 N62 A63 N89 Y90 G91 Y157 K161 P187 G188 I190 T192 R193 A194
BS02	TUD	C	G93 T94 T145 R155 Y158 G189 A196 N199 M200 F204	G92 T93 T144 R154 Y157 G188 A195 N198 M199 F203

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016491 oxidoreductase activity

Biological Process

• GO:0016042 lipid catabolic process
• GO:0030573 bile acid catabolic process

External links

• PDB: RCSB:5epo, PDBe:5epo, PDBj:5epo
• PDBsum: 5epo
• PubMed: 26961171
• UniProt: G9FRD7|HDHA_CLOSR 7alpha-hydroxysteroid dehydrogenase (Gene Name=hdha)