Structure of PDB 5dj4 Chain C

Receptor sequence

>5dj4C (length=364) Species: 9606 (Homo sapiens) [Search protein sequence]

GLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYI
AIMAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKL
LAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCG
ILPEGPPSEQSSPRDVEALMERMQQLQEEEMESRFELEKSESLPDMLCFV
EDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEK
FQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQL
LERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQA
ALLYALRAITRYMT

3D structure

PDB

5dj4 Structural basis for leucine sensing by the Sestrin2-mTORC1 pathway.

Chain

Resolution

2.697 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.11.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	LEU	C	T374 Y375 T377 T386 E451	T258 Y259 T261 T270 E335

Gene Ontology

	Molecular Function
GO:0004601	peroxidase activity
GO:0005092	GDP-dissociation inhibitor activity
GO:0005515	protein binding
GO:0016491	oxidoreductase activity
GO:0016684	oxidoreductase activity, acting on peroxide as acceptor
GO:0032542	sulfiredoxin activity
GO:0042731	PH domain binding
GO:0044877	protein-containing complex binding
GO:0070728	L-leucine binding
GO:0140311	protein sequestering activity

	Biological Process
GO:0001932	regulation of protein phosphorylation
GO:0006111	regulation of gluconeogenesis
GO:0006635	fatty acid beta-oxidation
GO:0007005	mitochondrion organization
GO:0009749	response to glucose
GO:0016239	positive regulation of macroautophagy
GO:0030308	negative regulation of cell growth
GO:0030330	DNA damage response, signal transduction by p53 class mediator
GO:0032042	mitochondrial DNA metabolic process
GO:0032868	response to insulin
GO:0034198	cellular response to amino acid starvation
GO:0034599	cellular response to oxidative stress
GO:0042149	cellular response to glucose starvation
GO:0042593	glucose homeostasis
GO:0046323	D-glucose import
GO:0051897	positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0070328	triglyceride homeostasis
GO:0071230	cellular response to amino acid stimulus
GO:0071233	cellular response to L-leucine
GO:0072593	reactive oxygen species metabolic process
GO:0098869	cellular oxidant detoxification
GO:1900182	positive regulation of protein localization to nucleus
GO:1901031	regulation of response to reactive oxygen species
GO:1902010	negative regulation of translation in response to endoplasmic reticulum stress
GO:1903432	regulation of TORC1 signaling
GO:1904262	negative regulation of TORC1 signaling
GO:1904263	positive regulation of TORC1 signaling
GO:1904504	positive regulation of lipophagy
GO:1990253	cellular response to leucine starvation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005765	lysosomal membrane
GO:0005829	cytosol
GO:0031588	nucleotide-activated protein kinase complex
GO:0031932	TORC2 complex
GO:1990316	Atg1/ULK1 kinase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5dj4, PDBe:5dj4, PDBj:5dj4
PDBsum	5dj4
PubMed	26586190
UniProt	P58004\|SESN2_HUMAN Sestrin-2 (Gene Name=SESN2)

[Back to BioLiP]