Structure of PDB 5df5 Chain C

Receptor sequence
>5df5C (length=104) Species: 10116 (Rattus norvegicus) [Search protein sequence]
GDVEKGKKIFVQKCAQCHTVEKGGKHKEGPNLHGLFGRKTGQAAGFSYTD
ANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK
ATNE
3D structure
PDB5df5 Phosphomimetic substitution of cytochrome C tyrosine 48 decreases respiration and binding to cardiolipin and abolishes ability to trigger downstream caspase activation.
ChainC
Resolution1.301 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEC C K13 C14 C17 H18 E28 G29 P30 G41 Y48 T49 N52 W59 Y67 T78 K79 M80 F82 K13 C14 C17 H18 E28 G29 P30 G41 Y48 T49 N52 W59 Y67 T78 K79 M80 F82
BS02 FC6 C K87 K88 G89 K87 K88 G89
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0019899 enzyme binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0002931 response to ischemia
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
GO:0006915 apoptotic process
GO:0006979 response to oxidative stress
GO:0009629 response to gravity
GO:0010730 negative regulation of hydrogen peroxide biosynthetic process
GO:0034349 glial cell apoptotic process
GO:0034465 response to carbon monoxide
GO:0042743 hydrogen peroxide metabolic process
GO:0046688 response to copper ion
GO:1901857 positive regulation of cellular respiration
Cellular Component
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0005829 cytosol
GO:0043293 apoptosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5df5, PDBe:5df5, PDBj:5df5
PDBsum5df5
PubMed
UniProtP62898|CYC_RAT Cytochrome c, somatic (Gene Name=Cycs)

[Back to BioLiP]