Structure of PDB 5dcv Chain C

Receptor sequence
>5dcvC (length=118) Species: 70601 (Pyrococcus horikoshii OT3) [Search protein sequence]
YVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAE
DVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPG
KARDLVEEIAMKVRELMK
3D structure
PDB5dcv Structural basis for recognition of a kink-turn motif by an archaeal homologue of human RNase P protein Rpp38
ChainC
Resolution3.401 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C R46 Q48 R40 Q42
BS02 rna C K35 G36 T37 N38 E39 D59 I63 I93 E94 V95 A96 A97 K29 G30 T31 N32 E33 D53 I57 I87 E88 V89 A90 A91
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5dcv, PDBe:5dcv, PDBj:5dcv
PDBsum5dcv
PubMed27114305
UniProtP62009|RL7A_PYRHO Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]