Structure of PDB 5cr2 Chain C

Receptor sequence
>5cr2C (length=110) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
SRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCT
TQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLI
KAKINVLIGH
3D structure
PDB5cr2 Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
ChainC
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.27.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C H28 R29 P30 C51 T52 H26 R27 P28 C49 T50 PDBbind-CN: Kd=0.52uM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0044877 protein-containing complex binding
GO:0140677 molecular function activator activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006402 mRNA catabolic process
GO:0006417 regulation of translation
GO:0009372 quorum sensing
GO:0016075 rRNA catabolic process
GO:0030308 negative regulation of cell growth
GO:0040008 regulation of growth
GO:0043068 positive regulation of programmed cell death
GO:0044010 single-species biofilm formation
GO:0051607 defense response to virus
Cellular Component
GO:0032991 protein-containing complex
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5cr2, PDBe:5cr2, PDBj:5cr2
PDBsum5cr2
PubMed27026704
UniProtP0AE70|MAZF_ECOLI Endoribonuclease toxin MazF (Gene Name=mazF)

[Back to BioLiP]