Structure of PDB 5c2v Chain C

Receptor sequence

>5c2vC (length=314) Species: 174633 (Candidatus Kuenenia stuttgartiensis)

GQPRVISTIQTGATWEPLGREEPLTVPEVHFRVKHSPFKSELVRYGQFQF
NDAAWSLQGSYSCASCHYERGQTTGLIWDLGDEGWGSWKNTKYIRGGRYL
PPFRHEGFTGHPDEIVGATSSLDRVCGRDPGFVFRSENFSPMRLEALICY
IRALEFTGSPFRNADGSLTEAQKRGQKIFEDPKVGCLECHPGDPMDPRAL
FSDAQTHDVGTGRVGVNGFRSTPGKVFNISALEAGEDPYGVESNTPIIGL
DLVKEFDTPTLRDIYASGTYFHDGGARTLMDTINNTVNDKDMHGRTSHLK
QQELQDLVEYLKAL

3D structure

• PDB: 5c2v The inner workings of the hydrazine synthase multiprotein complex.
• Chain: C
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 1.7.2.7: hydrazine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	C	N129 S306 G307 T308	N90 S267 G268 T269
BS02	CA	C	L139 P141 D296	L100 P102 D257
BS03	CA	C	D118 L119 E122 G123 S126	D79 L80 E83 G84 S87
BS04	HEC	C	Y100 C102 C105 H106 W117 K128 K131 F142 R143 H144 V164 C165 D168 F173	Y61 C63 C66 H67 W78 K89 K92 F103 R104 H105 V125 C126 D129 F134
BS05	HEC	C	C225 C228 H229 V248 T250 F295 T297 P298 L300 I303 Y309 F310 H311 H332	C186 C189 H190 V209 T211 F256 T258 P259 L261 I264 Y270 F271 H272 H293

Gene Ontology

Molecular Function

• GO:0004130 cytochrome-c peroxidase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0044222 anammoxosome

External links

• PDB: RCSB:5c2v, PDBe:5c2v, PDBj:5c2v
• PDBsum: 5c2v
• PubMed: 26479033
• UniProt: Q1Q0T3|HZSG_KUEST Hydrazine synthase subunit gamma (Gene Name=kuste2860)