Structure of PDB 5bqj Chain C

Receptor sequence

>5bqjC (length=75) Species: 4932 (Saccharomyces cerevisiae)

PQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPM
AILGFALSEATGLFCLMVSFLLLFG

3D structure

• PDB: 5bqj Oligomycin frames a common drug-binding site in the ATP synthase.
• Chain: C
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 3.6.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	E21	C	I52 A56 L63	I52 A56 L63

Gene Ontology

Molecular Function

• GO:0008289 lipid binding
• GO:0015078 proton transmembrane transporter activity
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding
• GO:0046933 proton-transporting ATP synthase activity, rotational mechanism

Biological Process

• GO:0015986 proton motive force-driven ATP synthesis
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005758 mitochondrial intermembrane space
• GO:0005829 cytosol
• GO:0016020 membrane
• GO:0031966 mitochondrial membrane
• GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain
• GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)

External links

• PDB: RCSB:5bqj, PDBe:5bqj, PDBj:5bqj
• PDBsum: 5bqj
• UniProt: P61829|ATP9_YEAST ATP synthase subunit 9, mitochondrial (Gene Name=OLI1)