Structure of PDB 5b5m Chain C

Receptor sequence

>5b5mC (length=317) Species: 1050 (Thermochromatium tepidum)

SVMLLGCEGPPPGTEQIGYRGVGMENYYNKRQRALSIQANQPVESLPAAD
STGPKASEVYQNVQVLKDLSVGEFTRTMVAVTTWVSPKEGCNYCHVPGNW
ASDDIYTKVVSRRMFELVRAANSDWKAHVAETGVTCYTCHRGNPVPKYAW
VTDPGPKYPSGLKPTGQNYGSKTVAYASLPFDPLTPFLDQANEIRITGNA
ALAGSNPASLKQAEWTFGLMMNISDSLGVGCTFCHNTRAFNDWTQSTPKR
TTAWYAIRHVRDINQNYIWPLNDVLPASRKGPYGDPLRVSCMTCHQAVNK
PLYGAQMAKDYPGLYKT

3D structure

• PDB: 5b5m Structural Basis for the Unusual Qy Red-Shift and Enhanced Thermostability of the LH1 Complex from Thermochromatium tepidum.
• Chain: C
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Y76 Q77 N78 Q80 V81 F90 M94 V97 T98 C107 C110 H111 W116 A117 K124 S127 R128	Y60 Q61 N62 Q64 V65 F74 M78 V81 T82 C91 C94 H95 W100 A101 K108 S111 R112
BS02	HEM	C	V101 Y122 V126 M130 L133 V134 C152 C155 H156 V161 P162 R295 L303 R304 V305	V85 Y106 V110 M114 L117 V118 C136 C139 H140 V145 P146 R279 L287 R288 V289
BS03	HEM	C	R211 I212 T213 T232 F233 M236 I239 S240 C247 C250 H251 F256 N257 R266 W270 R274	R195 I196 T197 T216 F217 M220 I223 S224 C231 C234 H235 F240 N241 R250 W254 R258
BS04	HEM	C	H144 A146 T148 V150 L243 K265 T268 A269 A272 I273 C307 C310 H311 N315 K316 P317	H128 A130 T132 V134 L227 K249 T252 A253 A256 I257 C291 C294 H295 N299 K300 P301

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding

Biological Process

• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0030077 plasma membrane light-harvesting complex

External links

• PDB: RCSB:5b5m, PDBe:5b5m, PDBj:5b5m
• PDBsum: 5b5m
• PubMed: 27933779
• UniProt: D2Z0P5|CYCR_THETI Photosynthetic reaction center cytochrome c subunit (Gene Name=pufC)