Structure of PDB 5awv Chain C

Receptor sequence

>5awvC (length=498) Species: 93944 (Nonomuraea gerenzanensis)

CLPPAGPVKVTPDDPRYLNLKLRGANSRFNGEPDYIHLVGSTQQVADAVE
ETVRTGKRVAVRSGGHCFEDFVDNPDVKVIIDMSLLTEIAYDPSMNAFLI
EPGNTLSEVYEKLYLGWNVTIPGGVCGGVGVGGHICGGGYGPLSRQFGSV
VDYLYAVEVVVVNKQGKARVIVATRERDDPHHDLWWAHTGGGGGNFGVVT
KYWMRVPEDVGRNPERLLPKPPATLLTSTVTFDWAGMTEAAFSRLLRNHG
EWYERNSGPDSPYTGLWSQLMIGNEVPGMGESGFMMPIQVDATRPDARRL
LDAHIEAVIDGVPPAEVPEPIEQRWLASTPGRGGRGPASKTKAGYLRKRL
TDRQIQAVYENMTHMDGIDYGAVWLIGYGGKVNTVDPAATALPQRDAILK
VNYITGWANPGNEAKHLTWVRKLYADVYAETGGVPVPNDVSDGAYINYPD
SDLADPGLNTSGVPWHDLYYKGNHPRLRKVKAAYDPRNHFHHALSIRP

3D structure

• PDB: 5awv Interception of teicoplanin oxidation intermediates yields new antimicrobial scaffolds.
• Chain: C
• Resolution: 1.93 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	S268 R269 R272 R374 D377	S243 R244 R247 R349 D352
BS02	peptide	C	V150 C151 T254 W292 Q294 G305 E306 P312 G356 R357 W399	V125 C126 T229 W267 Q269 G280 E281 P287 G331 R332 W374
BS03	FAD	C	V86 R87 S88 G89 G90 H91 C92 F96 V97 G149 C151 V154 G155 G157 G158 H159 Y165 G218 G219 V224 Y470 N472	V61 R62 S63 G64 G65 H66 C67 F71 V72 G124 C126 V129 G130 G132 G133 H134 Y140 G193 G194 V199 Y445 N447
BS04	MAN	C	D377 Q381	D352 Q356
BS05	T55	C	M304 D394 Y395 G431 W432	M279 D369 Y370 G406 W407
BS06	N1L	C	F93 Y473	F68 Y448

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004497 monooxygenase activity
• GO:0016491 oxidoreductase activity
• GO:0016746 acyltransferase activity
• GO:0016757 glycosyltransferase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0071949 FAD binding

External links

• PDB: RCSB:5awv, PDBe:5awv, PDBj:5awv
• PDBsum: 5awv
• PubMed: 21478878
• UniProt: Q7WZ62