Structure of PDB 5aus Chain C

Receptor sequence
>5ausC (length=83) Species: 608538 (Hydrogenobacter thermophilus TK-6) [Search protein sequence]
NEQLAKQKGCMACHDLKAGGGKKVGPAYADVAKKYAGRKDAVDYLAGKIK
KGGSGVWGSVPMPPQNVTDAEAKQLAQWILSIK
3D structure
PDB5aus Oligomerization enhancement and two domain swapping mode detection for thermostable cytochrome c552via the elongation of the major hinge loop.
ChainC
Resolution1.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC C M62 Q65 M62 Q65
BS02 HEC C C10 C13 H14 V24 G25 P26 Y28 Y35 Y44 K48 I49 S54 G55 V56 W57 C10 C13 H14 V24 G25 P26 Y28 Y35 Y44 K48 I49 S54 G55 V56 W57
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding

View graph for
Molecular Function
External links
PDB RCSB:5aus, PDBe:5aus, PDBj:5aus
PDBsum5aus
PubMed26451671
UniProtP15452|CY552_HYDTT Cytochrome c-552 (Gene Name=HTH_0988)

[Back to BioLiP]