Structure of PDB 5ark Chain C

Receptor sequence

>5arkC (length=119) Species: 9823 (Sus scrofa)

QDRMYQRFLRQHVDPDATGGNDAYCNLMMQRRKMTSHYCKRFNTFIHEDI
WNIRSICSTSNIQCKNGQMNCHEGVVKVTDCRETGSSRAPNCRYRAMAST
RRVVIACEGNPEVPVHFDK

3D structure

• PDB: 5ark Structural Basis of Substrate Specificity in Porcine Rnase 4.
• Chain: C
• Resolution: 2.28 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H12 K40 H116 F117 D118
• Catalytic site (residue number reindexed from 1): H12 K40 H116 F117 D118
• Enzyme Commision number: 3.1.27.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UMP	C	W51 P111	W51 P111
BS02	UMP	C	R7 Q11 H12 K40 F42 T44 H116 F117	R7 Q11 H12 K40 F42 T44 H116 F117

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding

External links

• PDB: RCSB:5ark, PDBe:5ark, PDBj:5ark
• PDBsum: 5ark
• PubMed: 26748441
• UniProt: P15468|RNAS4_PIG Ribonuclease 4 (Gene Name=RNASE4)