Structure of PDB 5aqd Chain C

Receptor sequence

>5aqdC (length=164) Species: 865859 (Phormidium rubidum A09DM) [Search protein sequence]

MKSVVTTVIAAADAAGRFPSSSDLESVQGSIQRSAARLEAAEKLAGNIDA
VAQEAYNACIQKYPYLNNSGEANSTDTFKAKCLRDVKHYMRLIQYSLVVG
GTGPLDEWGIAGQREVYRALGLPTAPYVEALSFARNRGCAPRDMSAQALT
EYNALLDYAINSLS

3D structure

PDB

5aqd Crystal Structure Analysis of C-Phycoerythrin from Marine Cyanobacterium Phormidium Sp. A09Dm.

Chain

Resolution

2.121 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	C	A72 N73 F78 K81 C82 R84 D85 H88 W108 V116 Y117 L122 P126 Y127	A72 N73 F78 K81 C82 R84 D85 H88 W108 V116 Y117 L122 P126 Y127
BS02	PEB	C	K43 L44 N47 V51 E54 R137 C139 R142 D143 M144 Y152	K43 L44 N47 V51 E54 R137 C139 R142 D143 M144 Y152
BS03	PEB	C	L24 E25 Q28	L24 E25 Q28
BS04	PEB	C	R33 Q147	R33 Q147

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5aqd, PDBe:5aqd, PDBj:5aqd
PDBsum	5aqd
PubMed	27068646
UniProt	A0A0E3W010

[Back to BioLiP]