Structure of PDB 5ab3 Chain C

Receptor sequence

>5ab3C (length=243) Species: 1192560 (Salmonella enterica subsp. enterica serovar Cubana str. 76814)

MIIPALNLIGGTVVRVVRLHQGDYARLRDYGNDPLPRLQDYAAQGAGVLH
LVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVA
RVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVENSGV
SLEQLVETYLPVGLKHVLCTDISRDGTLAGSNVSLYEEVCARYPQIAFQS
SGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN

3D structure

• PDB: 5ab3 Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
• Chain: C
• Resolution: 1.803 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N7 D129
• Catalytic site (residue number reindexed from 1): N7 D132
• Enzyme Commision number: 5.3.1.16: 1-(5-phosphoribosyl)-5- [(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	2ER	C	N7 R15C Y21 V49 G81 A102 S103 A127 D129 D176 G177 S202 G225 R226	N7 R18 Y24 V52 G84 A105 S106 A130 D132 D175 G176 S201 G224 R225

Gene Ontology

Molecular Function

• GO:0003949 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity
• GO:0016853 isomerase activity

Biological Process

• GO:0000105 L-histidine biosynthetic process
• GO:0000162 tryptophan biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5ab3, PDBe:5ab3, PDBj:5ab3
• PDBsum: 5ab3
• PubMed: 28416687
• UniProt: P10372|HIS4_SALTY 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (Gene Name=hisA)