Structure of PDB 4zyc Chain C

Receptor sequence

>4zycC (length=85) Species: 9606 (Homo sapiens)

TLVRPKPELLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIV
YCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVV

3D structure

• PDB: 4zyc Discovery of dihydroisoquinolinone derivatives as novel inhibitors of the p53-MDM2 interaction with a distinct binding mode.
• Chain: C
• Resolution: 1.95 Å

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	4SS	C	K51 L54 I61 Y67 F86 H96 I99	K26 L29 I36 Y42 F61 H71 I74

Gene Ontology

Biological Process

• GO:0043066 negative regulation of apoptotic process
• GO:0051726 regulation of cell cycle

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:4zyc, PDBe:4zyc, PDBj:4zyc
• PDBsum: 4zyc
• PubMed: 26141769
• UniProt: Q00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)