Structure of PDB 4zvp Chain C |
>4zvpC (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] |
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGF DVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGV TPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ |
|
PDB | 4zvp Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition. |
Chain | C |
Resolution | 2.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
C |
R387 H444 C486 |
R31 H88 C130 |
|
|
|
|