Structure of PDB 4zcc Chain C

Receptor sequence

>4zccC (length=321) Species: 264730 (Pseudomonas savastanoi pv. phaseolicola 1448A)

VPIAIIGTGIAGLSAAQALTSAGHQVHLFDKSRGSGGRMSSKRSSLDMGA
QYFTARDRRFATAVKQWQAQGHVSEWTPLLYNFHGGRLSPSPDEQVRWVG
EPGMSAITRAMRGDLPVSFSCRITDVFRGEQHWNLLDAESENHGPFSHVI
IATPAPQATALLAAAPKLASVVAGVKMDPTWAVALAFETPLQTPMQGCFV
QDSPLDWLARNRSKPGLDSWVLHATSQWSRQNLDASREQVIEHLHGAFAE
LIDCAMPAPVFSLAHRWLYARPAGSHEWGALSDADLGIYVCGDWCLSGRV
EGAWLSGQEAARRLLEHLQLE

3D structure

• PDB: 4zcc Bacterial Renalase: Structure and Kinetics of an Enzyme with 2- and 6-Dihydro-beta-NAD(P) Oxidase Activity from Pseudomonas phaseolicola.
• Chain: C
• Resolution: 1.997 Å

Enzymatic activity

• Enzyme Commision number: 1.6.3.5: renalase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	C	G9 G11 A13 D32 K33 G39 R40 G54 A55 Y57 I128 T158 P159 H232 W276 A279 D302 R308 A312	G7 G9 A11 D30 K31 G37 R38 G49 A50 Y52 I123 T153 P154 H223 W267 A270 D293 R299 A303
BS02	NAI	C	Y57 T59 R61 S96 D98 R102 T185 F204 H232 R280 R308	Y52 T54 R56 S91 D93 R97 T180 F199 H223 R271 R299	MOAD: Kd=81uM

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0050661 NADP binding
• GO:0050664 oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor
• GO:0051287 NAD binding
• GO:0071949 FAD binding

External links

• PDB: RCSB:4zcc, PDBe:4zcc, PDBj:4zcc
• PDBsum: 4zcc
• PubMed: 26016690
• UniProt: Q48MT7|RNLS_PSE14 Renalase (Gene Name=PSPPH_1014)