Structure of PDB 4ytp Chain C

Receptor sequence

>4ytpC (length=138) Species: 9823 (Sus scrofa)

TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAG
VSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNG
IRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM

3D structure

• PDB: 4ytp Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
• Chain: C
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	H45 R46 G49 L52 S53 H101 H108	H40 R41 G44 L47 S48 H96 H103
BS02	E23	C	I30 R46	I25 R41

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0006121 mitochondrial electron transport, succinate to ubiquinone

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0045273 respiratory chain complex II (succinate dehydrogenase)

External links

• PDB: RCSB:4ytp, PDBe:4ytp, PDBj:4ytp
• PDBsum: 4ytp
• PubMed: 26198225
• UniProt: D0VWV4|C560_PIG Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (Gene Name=SDHC)