Structure of PDB 4ytm Chain C

Receptor sequence
>4ytmC (length=152) Species: 6253 (Ascaris suum) [Search protein sequence]
EKTPIQVWGWDYLMRQRALKRPIAPHLTIYKPQMTWMVSGLHRVTGCAMA
GTLLIGGVGFSVLPLDFTTFVEFIRGLGIPWVILDTFKFIIAFPIAFHTL
NGIRFIGFDMAKGTDIPSIYRGAYLVLGLAALISLAVVVYPRWERHKKAT
LP
3D structure
PDB4ytm Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
ChainC
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM C H75 R76 G79 C80 M82 A83 H131 T132 H42 R43 G46 C47 M49 A50 H98 T99
BS02 F6A C L60 W69 S72 R76 L27 W36 S39 R43
BS03 EPH C T85 V170 T52 V137
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0006099 tricarboxylic acid cycle
GO:0006121 mitochondrial electron transport, succinate to ubiquinone
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0016020 membrane
GO:0031966 mitochondrial membrane
GO:0045273 respiratory chain complex II (succinate dehydrogenase)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ytm, PDBe:4ytm, PDBj:4ytm
PDBsum4ytm
PubMed26198225
UniProtP92506|DHSC_ASCSU Succinate dehydrogenase [ubiquinone] cytochrome b large subunit, mitochondrial (Gene Name=SDHC)

[Back to BioLiP]