Structure of PDB 4yey Chain C

Receptor sequence
>4yeyC (length=73) Species: 562 (Escherichia coli) [Search protein sequence]
AMNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGT
FKVNHAANVPAFVSGKALKDAVK
3D structure
PDB4yey HU multimerization shift controls nucleoid compaction.
ChainC
Resolution3.354 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C S17 T19 S18 T20
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0042802 identical protein binding
Biological Process
GO:0006270 DNA replication initiation
GO:0006281 DNA repair
GO:0006351 DNA-templated transcription
GO:0006974 DNA damage response
GO:0030261 chromosome condensation
GO:0036386 bacterial nucleoid packaging
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009295 nucleoid
GO:0016020 membrane
GO:1990103 DnaA-HU complex
GO:1990178 HU-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yey, PDBe:4yey, PDBj:4yey
PDBsum4yey
PubMed27482541
UniProtP0ACF0|DBHA_ECOLI DNA-binding protein HU-alpha (Gene Name=hupA)

[Back to BioLiP]