Structure of PDB 4xlw Chain C

Receptor sequence
>4xlwC (length=118) Species: 10116 (Rattus norvegicus) [Search protein sequence]
DECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQN
DATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGRCVDKINEFL
CQCPKGFSGHLCQSGRLE
3D structure
PDB4xlw Structural biology. Structural basis for Notch1 engagement of Delta-like 4.
ChainC
Resolution3.39 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BGC C E455 S458 F474 E42 S45 F61
BS02 FUC C D464 T466 M479 D51 T53 M66
BS03 BGC C S435 F436 S22 F23
BS04 BGC C E493 S496 F512 E80 S83 F99
BS05 CA C D414 E415 N431 T432 L433 G434 S435 D1 E2 N18 T19 L20 G21 S22
BS06 CA C D452 V453 E455 D469 Q470 D39 V40 E42 D56 Q57
BS07 CA C N490 T491 E493 D507 K508 N77 T78 E80 D94 K95
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:4xlw, PDBe:4xlw, PDBj:4xlw
PDBsum4xlw
PubMed25700513
UniProtQ07008|NOTC1_RAT Neurogenic locus notch homolog protein 1 (Gene Name=Notch1)

[Back to BioLiP]