Structure of PDB 4xgr Chain C |
>4xgrC (length=126) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] |
MMVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARF GEPGGRELDLWLHRAAVDLVAVHADQADAARAAYRTYGKAGLNYGDCFSY GLAKISGQPLLFKGEDFQHTDIATVA |
|
PDB | 4xgr Structural and functional studies of the Mycobacterium tuberculosis VapBC30 toxin-antitoxin system: implications for the design of novel antimicrobial peptides |
Chain | C |
Resolution | 2.7 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
C |
D4 G98 D99 |
D5 G95 D96 |
|
|
|
|