Structure of PDB 4x4s Chain C

Receptor sequence

>4x4sC (length=437) Species: 224325 (Archaeoglobus fulgidus DSM 4304)

MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYAR
NTWLKGSLEIDVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYV
HGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRL
LKGFLKANGIYGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTV
IDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPS
LGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERA
SRKIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFE
DERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD

3D structure

• PDB: 4x4s On-enzyme refolding permits small RNA and tRNA surveillance by the CCA-adding enzyme.
• Chain: C
• Resolution: 3.25 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.72: CCA tRNA nucleotidyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	D61 A95 E96 Y99 D110 V112 T130 A163 E164 Y165 R224 A228 N229 D291 N292 P295 Q296 R299 G346 P347 N354 K357 F358 R361 H396 H398 T399 G401 K402	D61 A95 E96 Y99 D110 V112 T130 A163 E164 Y165 R224 A228 N229 D291 N292 P295 Q296 R299 G346 P347 N354 K357 F358 R361 H396 H398 T399 G401 K402
BS02	CTP	C	S47 H133 Y161 S171 R224	S47 H133 Y161 S171 R224
BS03	MG	C	E59 D61	E59 D61

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0000287 magnesium ion binding
• GO:0003723 RNA binding
• GO:0004810 CCA tRNA nucleotidyltransferase activity
• GO:0005524 ATP binding
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding
• GO:0160016 CCACCA tRNA nucleotidyltransferase activity

Biological Process

• GO:0001680 tRNA 3'-terminal CCA addition
• GO:0008033 tRNA processing
• GO:0031123 RNA 3'-end processing
• GO:0042245 RNA repair
• GO:0106354 tRNA surveillance

External links

• PDB: RCSB:4x4s, PDBe:4x4s, PDBj:4x4s
• PDBsum: 4x4s
• PubMed: 25640237
• UniProt: O28126|CCA_ARCFU CCA-adding enzyme (Gene Name=cca)