Structure of PDB 4wfa Chain C

Receptor sequence

>4wfaC (length=199) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

NYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVK
NRSAVSGGGRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMP
KKMRRLALRSALSFKAQENGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKV
LVVTENEDVNVELSARNIPGVQVTTAQGLNVLDITNADSLVITEAAAKK

3D structure

PDB

4wfa Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.

Chain

Resolution

3.392 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	N29 R41 S43 L44 R45 Q46 T48 H49 N53 R54 S55 V57 S58 G59 G60 R62 K63 K66 Q67 K68 G69 G71 R72 A73 R74 Q75 G76 R79 P81 Q82 W83 R84 G85 I88 V89 F90 P92 R95 K100 M101 P102 K103 K104 M105 R106 E132 A133 E147 E164 Q179	N27 R39 S41 L42 R43 Q44 T46 H47 N51 R52 S53 V55 S56 G57 G58 R60 K61 K64 Q65 K66 G67 G69 R70 A71 R72 Q73 G74 R77 P79 Q80 W81 R82 G83 I86 V87 F88 P90 R93 K98 M99 P100 K101 K102 M103 R104 E130 A131 E145 E162 Q177

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4wfa, PDBe:4wfa, PDBj:4wfa
PDBsum	4wfa
PubMed	26464510
UniProt	Q2FW07\|RL4_STAA8 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]