Structure of PDB 4v2o Chain C |
>4v2oC (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] |
GASGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADIC KNYISQYSEIAIQMMMHMQPKEICALVGFCD |
|
PDB | 4v2o The Lysosomal Protein Saposin B Binds Chloroquine. |
Chain | C |
Resolution | 2.13 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CLQ |
C |
M61 M65 E69 |
M64 M68 E72 |
MOAD: Ka=31400M^-1 |
|
|
|