Structure of PDB 4v0w Chain C

Receptor sequence

>4v0wC (length=290) Species: 10090 (Mus musculus) [Search protein sequence]

MLNIDSIIQRLLEVRKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAY
KIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP
IAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPD
KDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAK
RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE

3D structure

PDB

4v0w G-actin provides substrate-specificity to eukaryotic initiation factor 2 alpha holophosphatases.

Chain

Resolution

1.55 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D64 H66 D92 D95 R96 N124 H125 H173 R221 H248
Catalytic site (residue number reindexed from 1)	D54 H56 D82 D85 R86 N114 H115 H163 R211 H238
Enzyme Commision number	3.1.3.16: protein-serine/threonine phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	C	D71 R74 Y78 R96 K98 D242 F257 P270 N271 C273 E287 L289 M290 C291 S292 F293 Q294 I295 L296 K297 P298 A299	D61 R64 Y68 R86 K88 D232 F247 P260 N261 C263 E277 L279 M280 C281 S282 F283 Q284 I285 L286 K287 P288 A289
BS02	MN	C	D64 H66 D92	D54 H56 D82
BS03	MN	C	D92 N124 H173 H248	D82 N114 H163 H238

Gene Ontology

	Molecular Function
GO:0004721	phosphoprotein phosphatase activity
GO:0004722	protein serine/threonine phosphatase activity
GO:0005515	protein binding
GO:0005521	lamin binding
GO:0008157	protein phosphatase 1 binding
GO:0016787	hydrolase activity
GO:0016791	phosphatase activity
GO:0017018	myosin phosphatase activity
GO:0019901	protein kinase binding
GO:0019903	protein phosphatase binding
GO:0019904	protein domain specific binding
GO:0044877	protein-containing complex binding
GO:0046872	metal ion binding

	Biological Process
GO:0001824	blastocyst development
GO:0005977	glycogen metabolic process
GO:0006470	protein dephosphorylation
GO:0007283	spermatogenesis
GO:0030182	neuron differentiation
GO:0032922	circadian regulation of gene expression
GO:0042752	regulation of circadian rhythm
GO:0043153	entrainment of circadian clock by photoperiod
GO:0046822	regulation of nucleocytoplasmic transport
GO:0048511	rhythmic process
GO:0051301	cell division
GO:0060252	positive regulation of glial cell proliferation

	Cellular Component
GO:0000775	chromosome, centromeric region
GO:0000776	kinetochore
GO:0000781	chromosome, telomeric region
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005741	mitochondrial outer membrane
GO:0005815	microtubule organizing center
GO:0005856	cytoskeleton
GO:0016607	nuclear speck
GO:0030496	midbody
GO:0032154	cleavage furrow
GO:0032991	protein-containing complex
GO:0043197	dendritic spine
GO:0072357	PTW/PP1 phosphatase complex
GO:0098793	presynapse
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v0w, PDBe:4v0w, PDBj:4v0w
PDBsum	4v0w
PubMed	25774600
UniProt	P63087\|PP1G_MOUSE Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (Gene Name=Ppp1cc)

[Back to BioLiP]