Structure of PDB 4upe Chain C

Receptor sequence
>4upeC (length=261) Species: 878 (Solidesulfovibrio fructosivorans) [Search protein sequence]
KHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAG
EAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAA
KAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPIN
FVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFD
SEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDF
WDTMTPFYEQG
3D structure
PDB4upe Crystallographic studies of [NiFe]-hydrogenase mutants: towards consensus structures for the elusive unready oxidized states.
ChainC
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C17 C20 C114 C147 H184 C187 C212 C218 C227 P238 C245 C248
Catalytic site (residue number reindexed from 1) C14 C17 C111 C144 H181 C184 C209 C215 C224 P235 C242 C245
Enzyme Commision number 1.12.2.1: cytochrome-c3 hydrogenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 C H184 C187 R189 L190 C212 L213 Y214 C218 P221 H181 C184 R186 L187 C209 L210 Y211 C215 P218
BS02 F3S C C227 F232 W237 P238 C245 L246 C248 C224 F229 W234 P235 C242 L243 C245
BS03 SF4 C C17 G19 C20 G112 C114 C147 P148 C14 G16 C17 G109 C111 C144 P145
Gene Ontology
Molecular Function
GO:0008901 ferredoxin hydrogenase activity
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0047806 cytochrome-c3 hydrogenase activity
GO:0051536 iron-sulfur cluster binding
GO:0051538 3 iron, 4 sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0009061 anaerobic respiration
Cellular Component
GO:0009375 ferredoxin hydrogenase complex
GO:0016020 membrane
GO:0042597 periplasmic space
GO:0044569 [Ni-Fe] hydrogenase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4upe, PDBe:4upe, PDBj:4upe
PDBsum4upe
PubMed25315838
UniProtP18187|PHNS_SOLFR Periplasmic [NiFe] hydrogenase small subunit (Gene Name=hydA)

[Back to BioLiP]