Structure of PDB 4ufw Chain C

Receptor sequence

>4ufwC (length=367) Species: 5855 (Plasmodium vivax)

DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVC
DVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWH
IGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAP
VLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGF
VEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPI
ENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTA
TFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLY
NWKCASFAPAHVGIVLL

3D structure

• PDB: 4ufw Discovery of Pyridyl-Based Inhibitors of Plasmodium Falciparum N-Myristoyltransferase
• Chain: C
• Resolution: 1.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N161 F162 L163 T197 L410
• Catalytic site (residue number reindexed from 1): N135 F136 L137 T171 L367
• Enzyme Commision number: 2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NHW	C	Y28 F30 W31 Y95 V96 N161 L163 C164 V165 R170 S171 R173 L174 A175 P176 I179 T183 I186 W192 Q193 A194 T197 L202 Y393	Y2 F4 W5 Y69 V70 N135 L137 C138 V139 R144 S145 R147 L148 A149 P150 I153 T157 I160 W166 Q167 A168 T171 L176 Y350
BS02	7Y6	C	E97 D98 F103 F105 Y107 Y211 S319 Y334 N365 A366 L410	E71 D72 F77 F79 Y81 Y185 S276 Y291 N322 A323 L367
BS03	MG	C	K172 L174	K146 L148

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity
• GO:0016746 acyltransferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006499 N-terminal protein myristoylation
• GO:0018008 N-terminal peptidyl-glycine N-myristoylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4ufw, PDBe:4ufw, PDBj:4ufw
• PDBsum: 4ufw
• PubMed: 26962430
• UniProt: A5K1A2