Structure of PDB 4u0y Chain C

Receptor sequence
>4u0yC (length=75) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MNINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMT
VRQALSNLVNEGLLYRLKGRGTFVS
3D structure
PDB4u0y Structural insight into operator dre-sites recognition and effector binding in the GntR/HutC transcription regulator NagR.
ChainC
Resolution1.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C S47 R48 M49 K68 G69 R70 S47 R48 M49 K68 G69 R70
BS02 dna C S36 E37 R52 R66 G69 R70 G71 T72 S36 E37 R52 R66 G69 R70 G71 T72
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4u0y, PDBe:4u0y, PDBj:4u0y
PDBsum4u0y
PubMed25564531
UniProtO34817|NAGR_BACSU HTH-type transcriptional repressor NagR (Gene Name=nagR)

[Back to BioLiP]