Structure of PDB 4tvq Chain C

Receptor sequence
>4tvqC (length=205) Species: 9606 (Homo sapiens) [Search protein sequence]
MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIK
AEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADEYMIERPEPEFQDL
NEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQ
NRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLIL
QTFKT
3D structure
PDB4tvq CCM2-CCM3 interaction stabilizes their protein expression and permits endothelial network formation.
ChainC
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C I131 A135 K139 L142 N146 S171 S175 K179 F182 I128 A132 K136 L139 N143 S166 S170 K174 F177
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019901 protein kinase binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0001525 angiogenesis
GO:0003158 endothelium development
GO:0006915 apoptotic process
GO:0008284 positive regulation of cell population proliferation
GO:0010628 positive regulation of gene expression
GO:0010629 negative regulation of gene expression
GO:0030335 positive regulation of cell migration
GO:0032874 positive regulation of stress-activated MAPK cascade
GO:0033138 positive regulation of peptidyl-serine phosphorylation
GO:0035023 regulation of Rho protein signal transduction
GO:0035556 intracellular signal transduction
GO:0036481 intrinsic apoptotic signaling pathway in response to hydrogen peroxide
GO:0043066 negative regulation of apoptotic process
GO:0043149 stress fiber assembly
GO:0043406 positive regulation of MAP kinase activity
GO:0044319 wound healing, spreading of cells
GO:0045747 positive regulation of Notch signaling pathway
GO:0045765 regulation of angiogenesis
GO:0050821 protein stabilization
GO:0051683 establishment of Golgi localization
GO:0071902 positive regulation of protein serine/threonine kinase activity
GO:0090051 negative regulation of cell migration involved in sprouting angiogenesis
GO:0090168 Golgi reassembly
GO:0090316 positive regulation of intracellular protein transport
GO:1903358 regulation of Golgi organization
GO:1903588 negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
GO:1990830 cellular response to leukemia inhibitory factor
Cellular Component
GO:0000139 Golgi membrane
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0070062 extracellular exosome
GO:0090443 FAR/SIN/STRIPAK complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4tvq, PDBe:4tvq, PDBj:4tvq
PDBsum4tvq
PubMed25825518
UniProtQ9BUL8|PDC10_HUMAN Programmed cell death protein 10 (Gene Name=PDCD10)

[Back to BioLiP]