Structure of PDB 4rjf Chain C

Receptor sequence

>4rjfC (length=253) Species: 9606 (Homo sapiens) [Search protein sequence]

MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQL
TLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLA
LVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRD
LSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNKEEEAVTIEMNEP
VQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLA
PKI

3D structure

PDB

4rjf p21 Exploits Residue Tyr151 as a Tether for High-Affinity PCNA Binding.

Chain

Resolution

2.0072 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	S32 S33 N36 N65 P129 E130	S32 S33 N36 N65 P129 E130
BS02	peptide	C	C27 D29 M40 H44 V45 D120 L121 V123 Q125 L126 G127 I128 P129 P234 A252 P253 K254 I255	C27 D29 M40 H44 V45 D120 L121 V123 Q125 L126 G127 I128 P129 P232 A250 P251 K252 I253

Gene Ontology

	Molecular Function
GO:0000701	purine-specific mismatch base pair DNA N-glycosylase activity
GO:0003677	DNA binding
GO:0003682	chromatin binding
GO:0003684	damaged DNA binding
GO:0005515	protein binding
GO:0019899	enzyme binding
GO:0030331	nuclear estrogen receptor binding
GO:0030337	DNA polymerase processivity factor activity
GO:0030971	receptor tyrosine kinase binding
GO:0032139	dinucleotide insertion or deletion binding
GO:0032405	MutLalpha complex binding
GO:0035035	histone acetyltransferase binding
GO:0042802	identical protein binding
GO:0044877	protein-containing complex binding
GO:0070182	DNA polymerase binding

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006260	DNA replication
GO:0006272	leading strand elongation
GO:0006275	regulation of DNA replication
GO:0006281	DNA repair
GO:0006287	base-excision repair, gap-filling
GO:0006298	mismatch repair
GO:0006979	response to oxidative stress
GO:0007507	heart development
GO:0019985	translesion synthesis
GO:0030855	epithelial cell differentiation
GO:0031297	replication fork processing
GO:0032077	positive regulation of deoxyribonuclease activity
GO:0032355	response to estradiol
GO:0033993	response to lipid
GO:0034644	cellular response to UV
GO:0044849	estrous cycle
GO:0045739	positive regulation of DNA repair
GO:0045740	positive regulation of DNA replication
GO:0046686	response to cadmium ion
GO:0070301	cellular response to hydrogen peroxide
GO:0071466	cellular response to xenobiotic stimulus
GO:0071548	response to dexamethasone
GO:0097421	liver regeneration
GO:1900264	positive regulation of DNA-directed DNA polymerase activity
GO:1902065	response to L-glutamate
GO:1902990	mitotic telomere maintenance via semi-conservative replication

	Cellular Component
GO:0000307	cyclin-dependent protein kinase holoenzyme complex
GO:0000781	chromosome, telomeric region
GO:0000785	chromatin
GO:0001673	male germ cell nucleus
GO:0005634	nucleus
GO:0005652	nuclear lamina
GO:0005654	nucleoplasm
GO:0005657	replication fork
GO:0005813	centrosome
GO:0016604	nuclear body
GO:0030894	replisome
GO:0043596	nuclear replication fork
GO:0043626	PCNA complex
GO:0070062	extracellular exosome
GO:0070557	PCNA-p21 complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4rjf, PDBe:4rjf, PDBj:4rjf
PDBsum	4rjf
PubMed	25972089
UniProt	P12004\|PCNA_HUMAN Proliferating cell nuclear antigen (Gene Name=PCNA)

[Back to BioLiP]