Structure of PDB 4rht Chain C

Receptor sequence

>4rhtC (length=161) Species: 83332 (Mycobacterium tuberculosis H37Rv)

KSVLLTAEQIQARIAELGEQIGNDYRTTGQDLLLITVLKGAVLFVTDLAR
AIPVPTQFEFMAVSSYGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWL
SRNLTSRNPRSLRVCTLLRKPDAVANVEIAYVGFDIPNDFVVGYGLDYDE
RYRDLSYIGTL

3D structure

• PDB: 4rht First Crystal Structures of Mycobacterium tuberculosis 6-Oxopurine Phosphoribosyltransferase: Complexes with GMP and Pyrophosphate and with Acyclic Nucleoside Phosphonates Whose Prodrugs Have Antituberculosis Activity.
• Chain: C
• Resolution: 2.7633 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E122 D123 D126 F175 R188
• Catalytic site (residue number reindexed from 1): E88 D89 D92 F140 R153
• Enzyme Commision number: 2.4.2.8: hypoxanthine phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	POP	C	K66 D182	K39 D147
BS02	5GP	C	V176 L181	V141 L146
BS03	MG	C	E122 D123	E88 D89

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004422 hypoxanthine phosphoribosyltransferase activity
• GO:0016757 glycosyltransferase activity
• GO:0046872 metal ion binding
• GO:0052657 guanine phosphoribosyltransferase activity

Biological Process

• GO:0006166 purine ribonucleoside salvage
• GO:0006177 GMP biosynthetic process
• GO:0006178 guanine salvage
• GO:0006188 IMP biosynthetic process
• GO:0032263 GMP salvage
• GO:0032264 IMP salvage
• GO:0043101 purine-containing compound salvage
• GO:0046100 hypoxanthine metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4rht, PDBe:4rht, PDBj:4rht
• PDBsum: 4rht
• PubMed: 25915781
• UniProt: P9WHQ9|HGPRT_MYCTU Hypoxanthine-guanine phosphoribosyltransferase (Gene Name=hpt)