Structure of PDB 4rb3 Chain C

Receptor sequence
>4rb3C (length=136) Species: 1430440 (Magnetospirillum gryphiswaldense MSR-1 v2) [Search protein sequence]
MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRI
SIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVI
EFTSPEIEALQREIARKHGFRLVGHRLELYGVPLTS
3D structure
PDB4rb3 Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
ChainC
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C K15 V16 Y56 R57 A78 K15 V16 Y56 R57 A78
BS02 dna C T17 Q19 R20 R49 I50 S51 T54 R57 T17 Q19 R20 R49 I50 S51 T54 R57
BS03 MN C H87 D89 E108 H125 H87 D89 E108 H125
BS04 MN C H33 E81 H88 H90 E101 H33 E81 H88 H90 E101
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900705 negative regulation of siderophore biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4rb3, PDBe:4rb3, PDBj:4rb3
PDBsum4rb3
PubMed26134419
UniProtV6F4Q0

[Back to BioLiP]