Structure of PDB 4r6q Chain C

Receptor sequence

>4r6qC (length=133) Species: 3490 (Artocarpus integer)

GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITG
FTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL

3D structure

• PDB: 4r6q Jacalin-carbohydrate interactions: distortion of the ligand molecule as a determinant of affinity.
• Chain: C
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	N105 P107 E109 N110 L133	N105 P107 E109 N110 L133
BS02	peptide	C	T72 F104 D125 Y126 F127 S128 M129 Y130 L131	T72 F104 D125 Y126 F127 S128 M129 Y130 L131
BS03	peptide	C	T10 F60 P61 L112 L133	T10 F60 P61 L112 L133
BS04	NBZ	C	Y78 Y122	Y78 Y122
BS05	GLA	C	G1 F47 Y78 G121 Y122 W123 D125	G1 F47 Y78 G121 Y122 W123 D125

Gene Ontology

Molecular Function

• GO:0019862 IgA binding
• GO:0030246 carbohydrate binding

Biological Process

• GO:0008150 biological_process

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:4r6q, PDBe:4r6q, PDBj:4r6q
• PDBsum: 4r6q
• PubMed: 25664742
• UniProt: P18670|LECA_ARTIN Agglutinin alpha chain