Structure of PDB 4qor Chain C

Receptor sequence

>4qorC (length=480) Species: 1408 (Bacillus pumilus)

HKNLTTNQGVPVGDNQNSRTAGHRGPSFLDDYHLIEKLAHFDRERIPERV
VHARGAGAYGVFEVENSMEKHTRAAFLSEEGKQTDVFVRFSTVIHPKGSP
ETLRDPRGFAVKFYTEEGNYDLVGNNLPIFFIRDALKFPDMVHSLKPDPV
TNIQDPDRYWDFMTLTPESTHMLTWLFSDEGIPANYAEMRGSGVHTFRWV
NKYGETKYVKYHWRPSEGIRNLSMEEAAEIQANDFQHATRDLYDRIEKGN
YPAWDLYVQLMPLSDYDELDYDPCDPTKTWSEEDYPLQKVGRMTLNRNPE
NFFAETEQAAFTPSALVPGIEASEDKLLQGRLFSYPDTQRHRLGANYMRI
PVNCPYAPVHNNQQDGFMTTTRPSGHINYEPNRYDDQPKENPHYKESEPV
LHGDRMVRQKIEKPNDFKQAGEKYRSYSEEEKQALIKNLTADLKGVNEKT
KLLAICNFYRADEDYGQRLADSLGVDIRSY

3D structure

• PDB: 4qor Unprecedented access of phenolic substrates to the heme active site of a catalase: Substrate binding and peroxidase-like reactivity of Bacillus pumilus catalase monitored by X-ray crystallography and EPR spectroscopy.
• Chain: C
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	R54 V56 H57 R94 G129 N130 F135 A140 F143 V199 F316 L332 R336 Y340 T343 Q344 R347	R49 V51 H52 R89 G124 N125 F130 A135 F138 V194 F311 L327 R331 Y335 T338 Q339 R342
BS02	HEM	C	R54 V56 H57 R94 V128 N130 F135 F143 V199 H200 F316 L332 R336 S339 Y340 T343 Q344 R347	R49 V51 H52 R89 V123 N125 F130 F138 V194 H195 F311 L327 R331 S334 Y335 T338 Q339 R342
BS03	2CH	C	R109 F136 L150 Y164 L181	R104 F131 L145 Y159 L176

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Nov 26 01:34:18 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4qor', asym_id = 'C', title = 'Unprecedented access of phenolic substrates to t...d by X-ray crystallography and EPR spectroscopy. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4qor', asym_id='C', title='Unprecedented access of phenolic substrates to t...d by X-ray crystallography and EPR spectroscopy. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004096,0006979,0020037', uniprot = '', pdbid = '4qor', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004096,0006979,0020037', uniprot='', pdbid='4qor', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>