Structure of PDB 4qlc Chain C

Receptor sequence
>4qlcC (length=104) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
KSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE
LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAV
LLPK
3D structure
PDB4qlc Structural Mechanisms of Nucleosome Recognition by Linker Histones.
ChainC
Resolution3.503 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C K14 R16 R28 R31 R76 K1 R3 R15 R18 R63 PDBbind-CN: Kd=0.35uM
BS02 dna C R28 R34 R41 V42 G43 A44 T75 R76 R15 R21 R28 V29 G30 A31 T62 R63 PDBbind-CN: Kd=0.35uM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0007526 larval somatic muscle development
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005700 polytene chromosome
GO:0005704 polytene chromosome band

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qlc, PDBe:4qlc, PDBj:4qlc
PDBsum4qlc
PubMed26212454
UniProtP84051|H2A_DROME Histone H2A (Gene Name=His2A)

[Back to BioLiP]