Structure of PDB 4qkb Chain C

Receptor sequence
>4qkbC (length=190) Species: 9606 (Homo sapiens) [Search protein sequence]
MWVRGSGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDH
WDAAIHGFRETEKSRWSEASMAIMRRVQAAAFGPQTLLSSVHVLDLEARG
YIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYI
LRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLP
3D structure
PDB4qkb The atomic resolution structure of human AlkB homolog 7 (ALKBH7), a key protein for programmed necrosis and fat metabolism
ChainC
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.14.11.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN C H121 D123 H177 H105 D107 H161
BS02 AKG C H121 D123 Y165 H177 R197 S199 R203 H105 D107 Y149 H161 R181 S183 R187
BS03 MN C E62 E75 E47 E60
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046872 metal ion binding
GO:0051213 dioxygenase activity
Biological Process
GO:0006631 fatty acid metabolic process
GO:0006974 DNA damage response
GO:0010883 regulation of lipid storage
GO:0012501 programmed cell death
GO:1902445 regulation of mitochondrial membrane permeability involved in programmed necrotic cell death
Cellular Component
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qkb, PDBe:4qkb, PDBj:4qkb
PDBsum4qkb
PubMed25122757
UniProtQ9BT30|ALKB7_HUMAN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 7, mitochondrial (Gene Name=ALKBH7)

[Back to BioLiP]