Structure of PDB 4qj2 Chain C

Receptor sequence

>4qj2C (length=99) Species: 11676 (Human immunodeficiency virus 1)

PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGV
GGFIKVRQYDQIPIEICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF

3D structure

• PDB: 4qj2 Structural basis and distal effects of Gag substrate coevolution in drug resistance to HIV-1 protease.
• Chain: C
• Resolution: 2.13 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N25 T26 G27
• Catalytic site (residue number reindexed from 1): N25 T26 G27

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	R8 G27 A28 D29 G48 F53 V82 I84	R8 G27 A28 D29 G48 F53 V82 I84

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:4qj2, PDBe:4qj2, PDBj:4qj2
• PDBsum: 4qj2
• PubMed: 25355911
• UniProt: O38710