Structure of PDB 4qdv Chain C

Receptor sequence

>4qdvC (length=289) Species: 9606 (Homo sapiens)

PVRLPFSGFRLQKVLRESARDKIIFLHGKGEDAVVILEKTPFQVEQVAQL
LTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQD
LRLIRETGDDYRNITLPHLESQSLSIQWVYNILDKKAEADRIVFENPDPS
DGFVLIPDLKWNQQQLDDLYLIAICHRRGIRSLRDLTPEHLPLLRNILHQ
GQEAILQRYRMKGDHLRVYLHYLPSYYHLHVHFTALGFEAPGSGVERAHL
LAEVIENLECDPRHYQQRTLTFALRADDPLLKLLQEAQQ

3D structure

• PDB: 4qdv Dcps in complex with covalent ligands targeting Tyrosines
• Chain: C
• Resolution: 2.8 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.59: 5'-(N(7)-methyl 5'-triphosphoguanosine)-[mRNA] diphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	30U	C	F108 Y113	F61 Y66

Gene Ontology

Molecular Function

• GO:0000340 RNA 7-methylguanosine cap binding
• GO:0004532 RNA exonuclease activity
• GO:0005515 protein binding
• GO:0016787 hydrolase activity
• GO:0042802 identical protein binding
• GO:0140932 5'-(N(7)-methyl 5'-triphosphoguanosine)-[mRNA] diphosphatase activity

Biological Process

• GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
• GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045292 mRNA cis splicing, via spliceosome
• GO:0110156 mRNA methylguanosine-cap decapping

Cellular Component

• GO:0000932 P-body
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005829 cytosol

External links

• PDB: RCSB:4qdv, PDBe:4qdv, PDBj:4qdv
• PDBsum: 4qdv
• UniProt: Q96C86|DCPS_HUMAN m7GpppX diphosphatase (Gene Name=DCPS)