Structure of PDB 4q3d Chain C

Receptor sequence

>4q3dC (length=248) Species: 269797 (Methanosarcina barkeri str. Fusaro)

INMQLQKADSAVQEVTGLDIKGICKALYGTFSSSEKVGIVPVTSGNGIIG
NFSASLHAITQYFGFDSFVTDMPDVSGYYEAVQNGAEIILMADDRTFLAH
NLKNGKMANNQPCTGIIYAEIASRYLKADSKDVLVVGLGKVGFPGAEHLV
QKDFRVYGYDADETLLERATSNLGIIPFDPANPKKFSIIFEATPCANTIP
EAVLSENCVLSTPGIPCAISEELRDKYEVQLIAEPLGIGTASMLYSVL

3D structure

• PDB: 4q3d The Formation of Pyrroline and Tetrahydropyridine Rings in Amino Acids Catalyzed by Pyrrolysine Synthase (PylD).
• Chain: C
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 1.4.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	C	N121 T125 G150 K151 V152 Y170 D171 A172 A203 T204 P205 C206 P224 P246 L247	N110 T114 G139 K140 V141 Y159 D160 A161 A192 T193 P194 C195 P213 P235 L236
BS02	MG	C	Y129 E245 L247 I249	Y118 E234 L236 I238
BS03	2YH	C	V53 I59 I60 F63 A103 D104 D105 R106	V42 I48 I49 F52 A92 D93 D94 R95

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity

Biological Process

• GO:0008652 amino acid biosynthetic process

External links

• PDB: RCSB:4q3d, PDBe:4q3d, PDBj:4q3d
• PDBsum: 4q3d
• PubMed: 24916332
• UniProt: Q46E80|PYLD_METBF Pyrrolysine synthase (Gene Name=pylD)