Structure of PDB 4pmi Chain C

Receptor sequence

>4pmiC (length=52) Species: 11707 (Human immunodeficiency virus type 1 (HXB3 ISOLATE))

LKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRARQRQIHSISERIRST
YL

3D structure

• PDB: 4pmi RNA-directed remodeling of the HIV-1 protein Rev orchestrates assembly of the Rev-Rev response element complex.
• Chain: C
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	R39 N40 R41 R42 R43 R44 R46 R50 R58	R27 N28 R29 R30 R31 R32 R34 R38 R46

Gene Ontology

Molecular Function

• GO:0003700 DNA-binding transcription factor activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription

Cellular Component

• GO:0042025 host cell nucleus

External links

• PDB: RCSB:4pmi, PDBe:4pmi, PDBj:4pmi
• PDBsum: 4pmi
• PubMed: 25486594
• UniProt: P69718|REV_HV1H3 Protein Rev (Gene Name=rev)