Structure of PDB 4p73 Chain C

Receptor sequence

>4p73C (length=239) Species: 208964 (Pseudomonas aeruginosa PAO1)

AAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDY
HNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRI
VCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEK
QLEVRFRPSFFPFTEPSAEVDIQCQTGWLEVMGCGMVHPNVLRMSNIDPE
KFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR

3D structure

• PDB: 4p73 The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
• Chain: C
• Resolution: 3.03 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H76 H90 R116 Q129 T172 A226
• Catalytic site (residue number reindexed from 1): H68 H82 R108 Q121 T164 A206
• Enzyme Commision number: 6.1.1.20: phenylalanine--tRNA ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GAX	C	L64 S92 Q95 M99 E131 F169 F171 G203 C204 A226 F227 G228	L56 S84 Q87 M91 E123 F161 F163 G183 C184 A206 F207 G208	PDBbind-CN: -logKd/Ki=7.66,IC50=22nM

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004812 aminoacyl-tRNA ligase activity
• GO:0004826 phenylalanine-tRNA ligase activity
• GO:0005524 ATP binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0006432 phenylalanyl-tRNA aminoacylation
• GO:0043039 tRNA aminoacylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4p73, PDBe:4p73, PDBj:4p73
• PDBsum: 4p73
• PubMed: 24936059
• UniProt: Q9I0A3|SYFA_PSEAE Phenylalanine--tRNA ligase alpha subunit (Gene Name=pheS)