Structure of PDB 4ogq Chain C

Receptor sequence

>4ogqC (length=281) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418)

YPFWAQQTYPETPREPTGRIVCANCHLAAKPTEVEVPQSVLPDTVFKAVV
KIPYDTSVQQVGADGSKVGLNVGAVLMLPEGFKIAPEDRIPEELKEEIGD
VYFQPYGEDKDNIVIVGPLPGEQYQEIVFPVLSPNPANDKNIHFGKYSVH
VGGNRGRGQVYPTGEKSNNNLYSAAATGTISKIAKQEGEDGSVKYLVDIS
DTIPAGPELIVSEGQAVTAGDALTNNPNVGGFGQLDAEIVLQDANRVGWL
IAFVALVMLAQVMLVLKKKQVEKVQAAEMNF

3D structure

• PDB: 4ogq Internal Lipid Architecture of the Hetero-Oligomeric Cytochrome b6f Complex.
• Chain: C
• Resolution: 2.501 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	Q38 S39 V255 M266 Q269 V270 V273 K276 K277	Q38 S39 V247 M258 Q261 V262 V265 K268 K269
BS02	HEC	C	Y1 P2 W4 A5 C22 C25 H26 Q60 L70 N71 V72 G73 A74 V75 N154 G156 R157 G158 V160 Y161	Y1 P2 W4 A5 C22 C25 H26 Q60 L70 N71 V72 G73 A74 V75 N154 G156 R157 G158 V160 Y161

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4ogq, PDBe:4ogq, PDBj:4ogq
• PDBsum: 4ogq
• PubMed: 24931468
• UniProt: Q93SW9|CYF_NOSS1 Cytochrome f (Gene Name=petA)