Structure of PDB 4od9 Chain C |
>4od9C (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] |
PIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDI ACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQS |
|
PDB | 4od9 Structure-based optimization of non-peptidic Cathepsin D inhibitors. |
Chain | C |
Resolution | 1.9 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2RZ |
C |
D33 Y78 G79 |
D32 Y77 G78 |
BindingDB: IC50=58nM |
|
|
|