Structure of PDB 4nb5 Chain C |
>4nb5C (length=147) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] |
PDIMEFVEQMGGYFESRSLTRLAGRLLGWLLVCDPERQSSEELATALAAS SGGISTNARMLIQFGFIERLAVAGDRRTYFRLRPNAFAAGERERIRAMAE LQDLADVGLRALGDAPPQRSRRLREMRDLLAYMENVVSDALGRYSQR |
|
PDB | 4nb5 Crystal Structure of the Transcriptional Regulator Rv0678 of Mycobacterium tuberculosis. |
Chain | C |
Resolution | 1.641 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2JT |
C |
R32 F102 G105 E106 |
R17 F87 G90 E91 |
|
|
|
|